PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016445562.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 449aa    MW: 48265.6 Da    PI: 4.6531
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016445562.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.7e-1698142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++++  ++G+g+Wk+I+r+  + Rt+ q+ s+ qk+
   XP_016445562.1  98 AWTEEEHKLFLKGLDKYGKGDWKSISRHCVLSRTPQQVASHAQKF 142
                      7******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.5859IPR001005SANT/Myb domain
SuperFamilySSF466895.38E-81063IPR009057Homeodomain-like
CDDcd001678.91E-41257No hitNo description
PROSITE profilePS500904.6231257IPR017877Myb-like domain
PROSITE profilePS5129419.94291147IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-1192144IPR009057Homeodomain-like
SuperFamilySSF466893.8E-1693147IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-1695145IPR006447Myb domain, plants
SMARTSM007171.6E-1195145IPR001005SANT/Myb domain
CDDcd001675.05E-1198143No hitNo description
PfamPF002494.3E-1298141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSTDRTCNGS FWTKEEDKIF ENTLAVYSSD DDLLMMMAAA LPGKSLEDIK NHYEVLVEDV  60
NAIESGLVPL PRYRNMQSHS LNKSRLPKAD VERRKGVAWT EEEHKLFLKG LDKYGKGDWK  120
SISRHCVLSR TPQQVASHAQ KFFNRREGVN KERRRASIHD ITSVDIETAG TSQVPNPENM  180
IGPAGGGSQV TASTNDMTGA VDSGVVSTGV GTFTSPIAAI ENKSMLPQEI TIAEPEIAVS  240
GGESSGPGAA FVNEVSRLYH DVTDDFILGI DDLIVEQEVT YEAGIQVDTE RSLLPSQQPS  300
TAAGNEIYGH PVTRIGSELE ALITEHMVED NEISSIFDVG KTPSSHAMLS STAHSGMSSY  360
TVAAHSGMPS YTVAAHSGMS SYTVGSFGSN NAPENRVAAP GGGLTIDSQQ LPSIAPSSNF  420
SVGVCPNSNT SVRDEGIFYL GDLFTDHMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-13874774RADIALIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016445568.10.0PREDICTED: uncharacterized protein LOC107770741
RefseqXP_016445562.10.0PREDICTED: uncharacterized protein LOC107770741
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44541329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-55MYB family protein